SCOPe 2.01: Domain d2bmub_: 2bmu B:

Lineage for d2bmub_ (2bmu B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (3 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187472] (3 PDB entries)

8. Domain d2bmub_: 2bmu B: [128814]
   automated match to d2bmua1
   complexed with anp, mg, u5p

Details for d2bmub_

PDB Entry: 2bmu, 2.55 Å

PDB Description: ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp

PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2bmub_:

Sequence; same for both SEQRES and ATOM records:

>d2bmub_ c.73.1.3 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
amrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfn
ssetfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpght
tdavaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekag
sssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

Timeline for d2bmub_:

• d2bmub_ first appeared in SCOP 1.73, called d2bmub1
  
• d2bmub_ was called d2bmub1 in SCOP 1.75
  
• d2bmub_ appears in SCOPe 2.02
  
• d2bmub_ appears in the current release, SCOPe 2.08