SCOP 1.73: Domain d2bmub1: 2bmu B:1-225

Lineage for d2bmub1 (2bmu B:1-225)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (3 proteins)
   part of Pfam PF00696

6. Protein Uridylate kinase PyrH [142728] (6 species)

7. Species Pyrococcus furiosus [TaxId:2261] [142731] (3 PDB entries)

8. Domain d2bmub1: 2bmu B:1-225 [128814]
   automatically matched to 2BRX A:1-225
   complexed with anp, mg, u5p

Details for d2bmub1

PDB Entry: 2bmu, 2.55 Å

PDB Description: ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp

PDB Compounds: (B:) uridylate kinase

SCOP Domain Sequences for d2bmub1:

Sequence; same for both SEQRES and ATOM records:

>d2bmub1 c.73.1.3 (B:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

Timeline for d2bmub1:

• d2bmub1 is new in SCOP 1.73
  
• d2bmub1 appears in SCOP 1.75
  
• d2bmub1 appears in the current release, SCOPe 2.08, called d2bmub_