Lineage for d2bmua1 (2bmu A:1-225)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843596Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 843597Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 843640Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 843660Protein Uridylate kinase PyrH [142728] (6 species)
  7. 843688Species Pyrococcus furiosus [TaxId:2261] [142731] (3 PDB entries)
    Uniprot Q8U122 1-225
  8. 843691Domain d2bmua1: 2bmu A:1-225 [128813]
    automatically matched to 2BRX A:1-225
    complexed with anp, mg, u5p

Details for d2bmua1

PDB Entry: 2bmu (more details), 2.55 Å

PDB Description: ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp
PDB Compounds: (A:) uridylate kinase

SCOP Domain Sequences for d2bmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmua1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

SCOP Domain Coordinates for d2bmua1:

Click to download the PDB-style file with coordinates for d2bmua1.
(The format of our PDB-style files is described here.)

Timeline for d2bmua1: