SCOPe 2.05: Domain d2bmrb_: 2bmr B:

Lineage for d2bmrb_ (2bmr B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein automated matches [190223] (4 species)
   not a true protein

7. Species Comamonas sp. [TaxId:58226] [186984] (2 PDB entries)

8. Domain d2bmrb_: 2bmr B: [128812]
   Other proteins in same PDB: d2bmra1, d2bmra2
   automated match to d1eg9b_
   complexed with 3nt, edo, eoh, fe, fes, ni

Details for d2bmrb_

PDB Entry: 2bmr, 1.5 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene

PDB Compounds: (B:) oxygenase-beta nbdo

SCOPe Domain Sequences for d2bmrb_:

Sequence; same for both SEQRES and ATOM records:

>d2bmrb_ d.17.4.4 (B:) automated matches {Comamonas sp. [TaxId: 58226]}
mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
peripqthnllvfl

Timeline for d2bmrb_:

• d2bmrb_ first appeared in SCOP 1.73, called d2bmrb1
  
• d2bmrb_ appears in SCOPe 2.04
  
• d2bmrb_ appears in SCOPe 2.06
  
• d2bmrb_ appears in the current release, SCOPe 2.08