![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Comamonas sp. [TaxId:58226] [186984] (2 PDB entries) |
![]() | Domain d2bmrb_: 2bmr B: [128812] Other proteins in same PDB: d2bmra1, d2bmra2 automated match to d1eg9b_ complexed with 3nt, edo, eoh, fe, fes, ni |
PDB Entry: 2bmr (more details), 1.5 Å
SCOPe Domain Sequences for d2bmrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmrb_ d.17.4.4 (B:) automated matches {Comamonas sp. [TaxId: 58226]} mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy peripqthnllvfl
Timeline for d2bmrb_: