Lineage for d2bmrb_ (2bmr B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. Protein automated matches [190223] (5 species)
    not a true protein
  7. Species Comamonas sp. [TaxId:58226] [186984] (2 PDB entries)
  8. Domain d2bmrb_: 2bmr B: [128812]
    Other proteins in same PDB: d2bmra1, d2bmra2
    automated match to d1eg9b_
    complexed with 3nt, edo, eoh, fe, fes, ni

Details for d2bmrb_

PDB Entry: 2bmr (more details), 1.5 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene
PDB Compounds: (B:) oxygenase-beta nbdo

SCOPe Domain Sequences for d2bmrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmrb_ d.17.4.4 (B:) automated matches {Comamonas sp. [TaxId: 58226]}
mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
peripqthnllvfl

SCOPe Domain Coordinates for d2bmrb_ are not available.

Timeline for d2bmrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bmra1, d2bmra2