Lineage for d2bmra2 (2bmr A:153-439)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582202Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2582275Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [143829] (1 species)
  7. 2582276Species Comamonas sp. JS765 [TaxId:58226] [143830] (3 PDB entries)
    Uniprot Q8RTL4 153-439
  8. 2582278Domain d2bmra2: 2bmr A:153-439 [128811]
    Other proteins in same PDB: d2bmra1, d2bmrb_
    automated match to d2bmoa2
    complexed with 3nt, edo, eoh, fe, fes, ni

Details for d2bmra2

PDB Entry: 2bmr (more details), 1.5 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene
PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmra2 d.129.3.3 (A:153-439) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
eapplidylgdaawyleptfkysgglelvgppgkvvvkanwksfaenfvgdgyhvgwtha
aalragqsvfssiagnaklppegaglqmtskygsgmgvfwgyysgnfsadmipdlmafga
akqeklakeigdvrariyrsflngtifpnnsfltgsaafrvwnpidenttevwtyafvek
dmpedlkrrvadavqrsigpagfwesddnenmetmsqngkkyqssnidqiaslgfgkdvy
gdecypgvvgksaigetsyrgfyrayqahisssnwaefenasrnwhi

SCOPe Domain Coordinates for d2bmra2:

Click to download the PDB-style file with coordinates for d2bmra2.
(The format of our PDB-style files is described here.)

Timeline for d2bmra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmra1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bmrb_