![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
![]() | Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species) |
![]() | Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries) Uniprot Q8RTL4 3-152 |
![]() | Domain d2bmra1: 2bmr A:3-152 [128810] Other proteins in same PDB: d2bmra2, d2bmrb_ automated match to d2bmoa1 complexed with 3nt, edo, eoh, fe, fes, ni |
PDB Entry: 2bmr (more details), 1.5 Å
SCOPe Domain Sequences for d2bmra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmra1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely gdaikkkclglkevpriesfhgfiygcfda
Timeline for d2bmra1: