SCOPe 2.08: Domain d2bmra1: 2bmr A:3-152

Lineage for d2bmra1 (2bmr A:3-152)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species)

7. Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries)
   Uniprot Q8RTL4 3-152

8. Domain d2bmra1: 2bmr A:3-152 [128810]
   Other proteins in same PDB: d2bmra2, d2bmrb_
   automated match to d2bmoa1
   complexed with 3nt, edo, eoh, fe, fes, ni

Details for d2bmra1

PDB Entry: 2bmr, 1.5 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene

PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmra1:

Sequence; same for both SEQRES and ATOM records:

>d2bmra1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
gdaikkkclglkevpriesfhgfiygcfda

Timeline for d2bmra1:

• d2bmra1 first appeared in SCOP 1.73
  
• d2bmra1 appears in SCOPe 2.07