| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
| Protein automated matches [190223] (5 species) not a true protein |
| Species Comamonas sp. [TaxId:58226] [186984] (2 PDB entries) |
| Domain d2bmqb_: 2bmq B: [128809] Other proteins in same PDB: d2bmqa1, d2bmqa2 automated match to d1eg9b_ complexed with edo, eoh, fe, fes, nbz, ni |
PDB Entry: 2bmq (more details), 1.55 Å
SCOPe Domain Sequences for d2bmqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmqb_ d.17.4.4 (B:) automated matches {Comamonas sp. [TaxId: 58226]}
mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
peripqthnllvfl
Timeline for d2bmqb_: