Lineage for d2bmqb_ (2bmq B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505646Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 protein domains)
    Pfam PF00866
  6. 2505702Protein automated matches [190223] (5 species)
    not a true protein
  7. 2505780Species Comamonas sp. [TaxId:58226] [186984] (2 PDB entries)
  8. 2505782Domain d2bmqb_: 2bmq B: [128809]
    Other proteins in same PDB: d2bmqa1, d2bmqa2
    automated match to d1eg9b_
    complexed with edo, eoh, fe, fes, nbz, ni

Details for d2bmqb_

PDB Entry: 2bmq (more details), 1.55 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with nitrobenzene
PDB Compounds: (B:) oxygenase-beta nbdo

SCOPe Domain Sequences for d2bmqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmqb_ d.17.4.4 (B:) automated matches {Comamonas sp. [TaxId: 58226]}
mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
peripqthnllvfl

SCOPe Domain Coordinates for d2bmqb_:

Click to download the PDB-style file with coordinates for d2bmqb_.
(The format of our PDB-style files is described here.)

Timeline for d2bmqb_: