Lineage for d2bmqa2 (2bmq A:153-439)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926476Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1926549Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [143829] (1 species)
  7. 1926550Species Comamonas sp. JS765 [TaxId:58226] [143830] (3 PDB entries)
    Uniprot Q8RTL4 153-439
  8. 1926553Domain d2bmqa2: 2bmq A:153-439 [128808]
    Other proteins in same PDB: d2bmqa1, d2bmqb_
    automated match to d2bmoa2
    complexed with edo, eoh, fe, fes, nbz, ni

Details for d2bmqa2

PDB Entry: 2bmq (more details), 1.55 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with nitrobenzene
PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmqa2 d.129.3.3 (A:153-439) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
eapplidylgdaawyleptfkysgglelvgppgkvvvkanwksfaenfvgdgyhvgwtha
aalragqsvfssiagnaklppegaglqmtskygsgmgvfwgyysgnfsadmipdlmafga
akqeklakeigdvrariyrsflngtifpnnsfltgsaafrvwnpidenttevwtyafvek
dmpedlkrrvadavqrsigpagfwesddnenmetmsqngkkyqssnidqiaslgfgkdvy
gdecypgvvgksaigetsyrgfyrayqahisssnwaefenasrnwhi

SCOPe Domain Coordinates for d2bmqa2:

Click to download the PDB-style file with coordinates for d2bmqa2.
(The format of our PDB-style files is described here.)

Timeline for d2bmqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bmqb_