Lineage for d2bmqa1 (2bmq A:3-152)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795913Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 795914Superfamily b.33.1: ISP domain [50022] (3 families) (S)
  5. 795986Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 796028Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species)
  7. 796029Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries)
    Uniprot Q8RTL4 3-152
  8. 796032Domain d2bmqa1: 2bmq A:3-152 [128807]
    Other proteins in same PDB: d2bmqa2, d2bmqb1
    automatically matched to 2BMO A:3-152
    complexed with edo, eoh, fe, fes, nbz, ni

Details for d2bmqa1

PDB Entry: 2bmq (more details), 1.55 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with nitrobenzene
PDB Compounds: (A:) oxygenase-alpha nbdo

SCOP Domain Sequences for d2bmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmqa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
gdaikkkclglkevpriesfhgfiygcfda

SCOP Domain Coordinates for d2bmqa1:

Click to download the PDB-style file with coordinates for d2bmqa1.
(The format of our PDB-style files is described here.)

Timeline for d2bmqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bmqb1