Lineage for d2bmob1 (2bmo B:1-194)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641078Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1641125Protein Nitrobenzene dioxygenase beta subunit, NBDO-beta [142999] (1 species)
  7. 1641126Species Comamonas sp. JS765 [TaxId:58226] [143000] (1 PDB entry)
    Uniprot Q8RTL3 1-194
  8. 1641127Domain d2bmob1: 2bmo B:1-194 [128806]
    Other proteins in same PDB: d2bmoa1, d2bmoa2
    complexed with edo, eoh, fe, fes, ni

Details for d2bmob1

PDB Entry: 2bmo (more details), 1.2 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase
PDB Compounds: (B:) oxygenase-beta nbdo

SCOPe Domain Sequences for d2bmob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmob1 d.17.4.4 (B:1-194) Nitrobenzene dioxygenase beta subunit, NBDO-beta {Comamonas sp. JS765 [TaxId: 58226]}
mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
peripqthnllvfl

SCOPe Domain Coordinates for d2bmob1:

Click to download the PDB-style file with coordinates for d2bmob1.
(The format of our PDB-style files is described here.)

Timeline for d2bmob1: