| Class b: All beta proteins [48724] (176 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
| Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species) |
| Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries) Uniprot Q8RTL4 3-152 |
| Domain d2bmoa1: 2bmo A:3-152 [128804] Other proteins in same PDB: d2bmoa2, d2bmob1 complexed with edo, eoh, fe, fes, ni |
PDB Entry: 2bmo (more details), 1.2 Å
SCOPe Domain Sequences for d2bmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
gdaikkkclglkevpriesfhgfiygcfda
Timeline for d2bmoa1: