SCOP 1.73: Domain d2bmlb1: 2bml B:194-318

Lineage for d2bmlb1 (2bml B:194-318)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
   Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn

4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family)

5. Family b.109.1.1: Cell wall binding repeat [69361] (3 proteins)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein Choline binding domain of autolysin C-LytA [69362] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [69363] (4 PDB entries)

8. Domain d2bmlb1: 2bml B:194-318 [128803]
   automatically matched to d1gvmf_
   complexed with p6g, pg4, so4, trs, xed

Details for d2bmlb1

PDB Entry: 2bml, 2.6 Å

PDB Description: ofloxacin-like antibiotics inhibit pneumococcal cell wall degrading virulence factors

PDB Compounds: (B:) autolysin

SCOP Domain Sequences for d2bmlb1:

Sequence; same for both SEQRES and ATOM records:

>d2bmlb1 b.109.1.1 (B:194-318) Choline binding domain of autolysin C-LytA {Streptococcus pneumoniae [TaxId: 1313]}
ypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkiadkwyyfne
egamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrpeftvepdg
litvk

Timeline for d2bmlb1:

• d2bmlb1 is new in SCOP 1.73
  
• d2bmlb1 appears in SCOP 1.75
  
• d2bmlb1 appears in the current release, SCOPe 2.08, called d2bmlb_