SCOPe 2.05: Domain d2bmla_: 2bml A:

Lineage for d2bmla_ (2bml A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
   Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn

4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family)

5. Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein automated matches [190222] (3 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [186983] (1 PDB entry)

8. Domain d2bmla_: 2bml A: [128802]
   automated match to d1gvmb_
   complexed with p6g, pg4, so4, trs, xed

Details for d2bmla_

PDB Entry: 2bml, 2.6 Å

PDB Description: ofloxacin-like antibiotics inhibit pneumococcal cell wall degrading virulence factors

PDB Compounds: (A:) autolysin

SCOPe Domain Sequences for d2bmla_:

Sequence; same for both SEQRES and ATOM records:

>d2bmla_ b.109.1.1 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkiadkwyyfne
egamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrpeftvepdg
litvk

Timeline for d2bmla_:

• d2bmla_ first appeared in SCOP 1.73, called d2bmla1
  
• d2bmla_ appears in SCOPe 2.04
  
• d2bmla_ appears in SCOPe 2.06
  
• d2bmla_ appears in the current release, SCOPe 2.08