Lineage for d2bmla1 (2bml A:194-318)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679392Fold b.109: beta-hairpin stack [69359] (1 superfamily)
    Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn
  4. 679393Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) (S)
  5. 679394Family b.109.1.1: Cell wall binding repeat [69361] (3 proteins)
    this is a repeat family; one repeat unit is 2bib A:415-315 found in domain
  6. 679399Protein Choline binding domain of autolysin C-LytA [69362] (1 species)
  7. 679400Species Streptococcus pneumoniae [TaxId:1313] [69363] (4 PDB entries)
  8. 679403Domain d2bmla1: 2bml A:194-318 [128802]
    automatically matched to d1gvmf_
    complexed with p6g, pg4, so4, trs, xed

Details for d2bmla1

PDB Entry: 2bml (more details), 2.6 Å

PDB Description: ofloxacin-like antibiotics inhibit pneumococcal cell wall degrading virulence factors
PDB Compounds: (A:) autolysin

SCOP Domain Sequences for d2bmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmla1 b.109.1.1 (A:194-318) Choline binding domain of autolysin C-LytA {Streptococcus pneumoniae [TaxId: 1313]}
ypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkiadkwyyfne
egamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrpeftvepdg
litvk

SCOP Domain Coordinates for d2bmla1:

Click to download the PDB-style file with coordinates for d2bmla1.
(The format of our PDB-style files is described here.)

Timeline for d2bmla1: