![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.109: beta-hairpin stack [69359] (1 superfamily) Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn |
![]() | Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) ![]() |
![]() | Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins) this is a repeat family; one repeat unit is 2bib A:415-315 found in domain |
![]() | Protein automated matches [190222] (3 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [186983] (1 PDB entry) |
![]() | Domain d2bmla_: 2bml A: [128802] automated match to d1gvmb_ complexed with p6g, pg4, so4, trs, xed |
PDB Entry: 2bml (more details), 2.6 Å
SCOPe Domain Sequences for d2bmla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmla_ b.109.1.1 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ypkdkfekingtwyyfdssgymladrwrkhtdgnwywfdnsgematgwkkiadkwyyfne egamktgwvkykdtwyyldakegamvsnafiqsadgtgwyylkpdgtladrpeftvepdg litvk
Timeline for d2bmla_: