Lineage for d2bmkl2 (2bmk L:108-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518210Domain d2bmkl2: 2bmk L:108-214 [128801]
    Other proteins in same PDB: d2bmka1, d2bmkb1, d2bmkb2, d2bmkh1, d2bmkh2, d2bmkl1
    automated match to d1tqbc2
    complexed with iod, pdd

Details for d2bmkl2

PDB Entry: 2bmk (more details), 2.3 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
PDB Compounds: (L:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d2bmkl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmkl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2bmkl2:

Click to download the PDB-style file with coordinates for d2bmkl2.
(The format of our PDB-style files is described here.)

Timeline for d2bmkl2: