Lineage for d2bmka1 (2bmk A:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766870Domain d2bmka1: 2bmk A:1-107 [128798]
    Other proteins in same PDB: d2bmka2, d2bmkb1, d2bmkb2, d2bmkh1, d2bmkh2, d2bmkl2
    automated match to d1a5fl1
    complexed with iod, pdd

Details for d2bmka1

PDB Entry: 2bmk (more details), 2.3 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d2bmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmka1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

SCOPe Domain Coordinates for d2bmka1:

Click to download the PDB-style file with coordinates for d2bmka1.
(The format of our PDB-style files is described here.)

Timeline for d2bmka1: