Lineage for d2bmja1 (2bmj A:66-240)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866830Protein Centaurin gamma 1, G domain [142249] (1 species)
  7. 2866831Species Human (Homo sapiens) [TaxId:9606] [142250] (1 PDB entry)
    Uniprot Q99490 402-576
  8. 2866832Domain d2bmja1: 2bmj A:66-240 [128797]

Details for d2bmja1

PDB Entry: 2bmj (more details), 2.1 Å

PDB Description: gtpase like domain of centaurin gamma 1 (human)
PDB Compounds: (A:) centaurin gamma 1

SCOPe Domain Sequences for d2bmja1:

Sequence, based on SEQRES records: (download)

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}
rsipelrlgvlgdarsgksslihrfltgsyqvlekteseqykkemlvdgqthlvlireea
gapdakfsgwadavifvfsledensfqavsrlhgqlsslrgegrgglalalvgtqdrisa
ssprvvgdararalcadmkrcsyyetcatyglnvdrvfqevaqkvvtlrkqqqll

Sequence, based on observed residues (ATOM records): (download)

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}
rsipelrlgvlgdarsgksslihrfltgsyqvlekteseqykkemlvdgqthlvlireea
gapdakfsgwadavifvfsledensfqavsrlhgqlsslrgrgglalalvgtqdrisass
prvvgdararalcadmkrcsyyetcatyglnvdrvfqevaqkvvtlrkqqqll

SCOPe Domain Coordinates for d2bmja1:

Click to download the PDB-style file with coordinates for d2bmja1.
(The format of our PDB-style files is described here.)

Timeline for d2bmja1: