| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.14: RNA helicase [52724] (7 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
| Protein Dengue virus helicase, C-terminal domain [418961] (1 species) |
| Species Dengue virus type 2 [TaxId:11060] [419423] (2 PDB entries) Uniprot Q91H74 |
| Domain d2bmfa1: 2bmf A:483-618 [128791] Other proteins in same PDB: d2bmfa2, d2bmfa3, d2bmfb2, d2bmfb3 automated match to d2bhra1 |
PDB Entry: 2bmf (more details), 2.41 Å
SCOPe Domain Sequences for d2bmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmfa1 c.37.1.14 (A:483-618) Dengue virus helicase, C-terminal domain {Dengue virus type 2 [TaxId: 11060]}
edcahwkeakmlldnintpegiipsmfeperekvdaidgeyrlrgearktfvdlmrrgdl
pvwlayrvaaeginyadrrwcfdgvknnqileenveveiwtkegerkklkprwldariys
dplalkefkefaagrk
Timeline for d2bmfa1: