SCOP 1.73: Domain d2bm9d1: 2bm9 D:2-233

Lineage for d2bm9d1 (2bm9 D:2-233)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.50: CmcI-like [142632] (1 protein)
   Pfam PF04989; may have evolved different enzymatic activity

6. Protein Cephalosporin hydroxylase CmcI [142633] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)

8. Domain d2bm9d1: 2bm9 D:2-233 [128786]
   automatically matched to 2BM8 A:2-233
   complexed with sam; mutant

Details for d2bm9d1

PDB Entry: 2bm9, 2.94 Å

PDB Description: cmci-n160 in complex with sam

PDB Compounds: (D:) cephalosporin hydroxylase cmci

SCOP Domain Sequences for d2bm9d1:

Sequence; same for both SEQRES and ATOM records:

>d2bm9d1 c.66.1.50 (D:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
ndysrqnfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
cqipasdmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegd
yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva

Timeline for d2bm9d1:

• d2bm9d1 is new in SCOP 1.73
  
• d2bm9d1 appears in SCOP 1.75
  
• d2bm9d1 appears in the current release, SCOPe 2.08, called d2bm9d_