SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bm9b_ (2bm9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130413Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 2130414Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 2130415Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
    Uniprot O85726 2-233
  8. 2130447Domain d2bm9b_: 2bm9 B: [128784]
    automated match to d2bm8a1
    complexed with sam

Details for d2bm9b_

PDB Entry: 2bm9 (more details), 2.94 Å

PDB Description: cmci-n160 in complex with sam
PDB Compounds: (B:) cephalosporin hydroxylase cmci

SCOPe Domain Sequences for d2bm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm9b_ c.66.1.50 (B:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
ysrqnfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglrm
lkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrcq
ipasdmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegdyf
iiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaa

SCOPe Domain Coordinates for d2bm9b_:

Click to download the PDB-style file with coordinates for d2bm9b_.
(The format of our PDB-style files is described here.)

Timeline for d2bm9b_: