Lineage for d2bm8l_ (2bm8 L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894256Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 2894257Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 2894258Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
    Uniprot O85726 2-233
  8. 2894270Domain d2bm8l_: 2bm8 L: [128782]
    automated match to d2bm8a1

Details for d2bm8l_

PDB Entry: 2bm8 (more details), 2.5 Å

PDB Description: cmci-n160 apo-structure
PDB Compounds: (L:) cephalosporin hydroxylase cmci

SCOPe Domain Sequences for d2bm8l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm8l_ c.66.1.50 (L:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
ndysrqnfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
cqipasdmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegd
yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaa

SCOPe Domain Coordinates for d2bm8l_:

Click to download the PDB-style file with coordinates for d2bm8l_.
(The format of our PDB-style files is described here.)

Timeline for d2bm8l_: