Lineage for d2bm8k_ (2bm8 K:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501954Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 2501955Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 2501956Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
    Uniprot O85726 2-233
  8. 2501967Domain d2bm8k_: 2bm8 K: [128781]
    automated match to d2bm8a1

Details for d2bm8k_

PDB Entry: 2bm8 (more details), 2.5 Å

PDB Description: cmci-n160 apo-structure
PDB Compounds: (K:) cephalosporin hydroxylase cmci

SCOPe Domain Sequences for d2bm8k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm8k_ c.66.1.50 (K:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
dysrqnfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglr
mlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrc
qipasdmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegdy
fiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva

SCOPe Domain Coordinates for d2bm8k_:

Click to download the PDB-style file with coordinates for d2bm8k_.
(The format of our PDB-style files is described here.)

Timeline for d2bm8k_: