SCOPe 2.04: Domain d2bm7c_: 2bm7 C:

Lineage for d2bm7c_ (2bm7 C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families)
   superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands

5. Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
   Pfam PF00805 (covers eight repeats or two full superhelical turns)
   this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain

6. Protein automated matches [190517] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187473] (4 PDB entries)

8. Domain d2bm7c_: 2bm7 C: [128770]
   automated match to d2bm4a1

Details for d2bm7c_

PDB Entry: 2bm7, 2.7 Å

PDB Description: the structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.

PDB Compounds: (C:) pentapeptide repeat family protein

SCOPe Domain Sequences for d2bm7c_:

Sequence; same for both SEQRES and ATOM records:

>d2bm7c_ b.80.8.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhst
faqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkcv
lrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglclagg

Timeline for d2bm7c_:

• d2bm7c_ first appeared in SCOP 1.73, called d2bm7c1
  
• d2bm7c_ appears in SCOPe 2.03
  
• d2bm7c_ appears in SCOPe 2.05
  
• d2bm7c_ appears in the current release, SCOPe 2.08