SCOP 1.73: Domain d2bm7c1: 2bm7 C:4-182

Lineage for d2bm7c1 (2bm7 C:4-182)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.8: Pentapeptide repeat-like [141571] (1 family)
   superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands

5. Family b.80.8.1: Pentapeptide repeats [141572] (3 proteins)
   Pfam PF00805 (covers eight repeats or two full superhelical turns)
   this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain

6. Protein Hypothetical protein Rv3361c (MT3469) [141573] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [141574] (4 PDB entries)

8. Domain d2bm7c1: 2bm7 C:4-182 [128770]
   automatically matched to 2BM4 A:2-182

Details for d2bm7c1

PDB Entry: 2bm7, 2.7 Å

PDB Description: the structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.

PDB Compounds: (C:) pentapeptide repeat family protein

SCOP Domain Sequences for d2bm7c1:

Sequence; same for both SEQRES and ATOM records:

>d2bm7c1 b.80.8.1 (C:4-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]}
wvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhst
faqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkcv
lrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglclag

Timeline for d2bm7c1:

• d2bm7c1 is new in SCOP 1.73
  
• d2bm7c1 appears in SCOP 1.75
  
• d2bm7c1 appears in the current release, SCOPe 2.08, called d2bm7c_