Class b: All beta proteins [48724] (176 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands |
Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins) Pfam PF00805 (covers eight repeats or two full superhelical turns) this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain |
Protein automated matches [190517] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187473] (4 PDB entries) |
Domain d2bm7b_: 2bm7 B: [128769] automated match to d2bm4a1 |
PDB Entry: 2bm7 (more details), 2.7 Å
SCOPe Domain Sequences for d2bm7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bm7b_ b.80.8.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} qwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhs tfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkc vlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglclag g
Timeline for d2bm7b_: