Lineage for d2bm5b1 (2bm5 B:2-181)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676845Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 677046Superfamily b.80.8: Pentapeptide repeat-like [141571] (1 family) (S)
    superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands
  5. 677047Family b.80.8.1: Pentapeptide repeats [141572] (3 proteins)
    Pfam PF00805 (covers eight repeats or two full superhelical turns)
    this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain
  6. 677048Protein Hypothetical protein Rv3361c (MT3469) [141573] (1 species)
  7. 677049Species Mycobacterium tuberculosis [TaxId:1773] [141574] (4 PDB entries)
  8. 677051Domain d2bm5b1: 2bm5 B:2-181 [128766]
    automatically matched to 2BM4 A:2-182
    complexed with so4

Details for d2bm5b1

PDB Entry: 2bm5 (more details), 2 Å

PDB Description: the structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.
PDB Compounds: (B:) pentapeptide repeat family protein

SCOP Domain Sequences for d2bm5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm5b1 b.80.8.1 (B:2-181) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]}
qqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwh
stfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrk
cvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcla

SCOP Domain Coordinates for d2bm5b1:

Click to download the PDB-style file with coordinates for d2bm5b1.
(The format of our PDB-style files is described here.)

Timeline for d2bm5b1: