![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) ![]() superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands |
![]() | Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins) Pfam PF00805 (covers eight repeats or two full superhelical turns) this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain |
![]() | Protein automated matches [190517] (1 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [187473] (4 PDB entries) |
![]() | Domain d2bm5a_: 2bm5 A: [128765] automated match to d2bm4a1 complexed with so4 |
PDB Entry: 2bm5 (more details), 2 Å
SCOPe Domain Sequences for d2bm5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bm5a_ b.80.8.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mqqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlw hstfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlr kcvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcl agg
Timeline for d2bm5a_: