SCOPe 2.08: Domain d2bm4b_: 2bm4 B:

Lineage for d2bm4b_ (2bm4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families)
   superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands

5. Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
   Pfam PF00805 (covers eight repeats or two full superhelical turns)
   this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain

6. Protein automated matches [190517] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187473] (4 PDB entries)

8. Domain d2bm4b_: 2bm4 B: [128764]
   Other proteins in same PDB: d2bm4a1
   automated match to d2bm4a1

Details for d2bm4b_

PDB Entry: 2bm4, 2.2 Å

PDB Description: the structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.

PDB Compounds: (B:) pentapeptide repeat family protein

SCOPe Domain Sequences for d2bm4b_:

Sequence; same for both SEQRES and ATOM records:

>d2bm4b_ b.80.8.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwhs
tfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrkc
vlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglclag

Timeline for d2bm4b_:

• d2bm4b_ first appeared in SCOP 1.73, called d2bm4b1
  
• d2bm4b_ appears in SCOPe 2.07