Lineage for d2bm4a1 (2bm4 A:2-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813805Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) (S)
    superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands
  5. 2813806Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
    Pfam PF00805 (covers eight repeats or two full superhelical turns)
    this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain
  6. 2813807Protein Hypothetical protein Rv3361c (MT3469) [141573] (1 species)
  7. 2813808Species Mycobacterium tuberculosis [TaxId:1773] [141574] (1 PDB entry)
    Uniprot O50390 2-182
  8. 2813809Domain d2bm4a1: 2bm4 A:2-182 [128763]
    Other proteins in same PDB: d2bm4b_

Details for d2bm4a1

PDB Entry: 2bm4 (more details), 2.2 Å

PDB Description: the structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.
PDB Compounds: (A:) pentapeptide repeat family protein

SCOPe Domain Sequences for d2bm4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm4a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]}
qqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwh
stfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrk
cvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcla
g

SCOPe Domain Coordinates for d2bm4a1:

Click to download the PDB-style file with coordinates for d2bm4a1.
(The format of our PDB-style files is described here.)

Timeline for d2bm4a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bm4b_