![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries) Uniprot P71143 30-191! Uniprot P71143 30-195 |
![]() | Domain d2bm3a1: 2bm3 A:5-166 [128762] complexed with ipa |
PDB Entry: 2bm3 (more details), 1.8 Å
SCOPe Domain Sequences for d2bm3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bm3a1 b.2.2.2 (A:5-166) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]} kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpd
Timeline for d2bm3a1: