Lineage for d2bm3a1 (2bm3 A:5-166)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938452Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 938466Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 938523Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)
  7. 938524Species Clostridium thermocellum [TaxId:1515] [141079] (3 PDB entries)
    Uniprot P71143 30-191! Uniprot P71143 30-195
  8. 938525Domain d2bm3a1: 2bm3 A:5-166 [128762]
    complexed with ipa

Details for d2bm3a1

PDB Entry: 2bm3 (more details), 1.8 Å

PDB Description: Structure of the Type II cohesin from Clostridium thermocellum SdbA
PDB Compounds: (A:) scaffolding dockerin binding protein a

SCOPe Domain Sequences for d2bm3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm3a1 b.2.2.2 (A:5-166) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpd

SCOPe Domain Coordinates for d2bm3a1:

Click to download the PDB-style file with coordinates for d2bm3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bm3a1: