SCOPe 2.08: Domain d2bm3a1: 2bm3 A:5-166

Lineage for d2bm3a1 (2bm3 A:5-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries)
   Uniprot P71143 30-191! Uniprot P71143 30-195

8. Domain d2bm3a1: 2bm3 A:5-166 [128762]
   complexed with ipa

Details for d2bm3a1

PDB Entry: 2bm3, 1.8 Å

PDB Description: Structure of the Type II cohesin from Clostridium thermocellum SdbA

PDB Compounds: (A:) scaffolding dockerin binding protein a

SCOPe Domain Sequences for d2bm3a1:

Sequence; same for both SEQRES and ATOM records:

>d2bm3a1 b.2.2.2 (A:5-166) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpd

Timeline for d2bm3a1:

• d2bm3a1 first appeared in SCOP 1.73
  
• d2bm3a1 appears in SCOPe 2.07