Lineage for d2bm2b_ (2bm2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2794983Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 2794984Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries)
  8. 2795025Domain d2bm2b_: 2bm2 B: [128759]
    automated match to d1a0la_
    complexed with pm2

Details for d2bm2b_

PDB Entry: 2bm2 (more details), 2.2 Å

PDB Description: human beta-ii tryptase in complex with 4-(3-aminomethyl-phenyl)- piperidin-1-yl-(5-phenethyl- pyridin-3-yl)-methanone
PDB Compounds: (B:) human beta2 tryptase

SCOPe Domain Sequences for d2bm2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm2b_ b.47.1.2 (B:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2bm2b_:

Click to download the PDB-style file with coordinates for d2bm2b_.
(The format of our PDB-style files is described here.)

Timeline for d2bm2b_: