Lineage for d2bm2a1 (2bm2 A:16-244)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670432Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 670433Species Human (Homo sapiens) [TaxId:9606] [50547] (8 PDB entries)
  8. 670438Domain d2bm2a1: 2bm2 A:16-244 [128758]
    automatically matched to d1a0la_
    complexed with pm2

Details for d2bm2a1

PDB Entry: 2bm2 (more details), 2.2 Å

PDB Description: human beta-ii tryptase in complex with 4-(3-aminomethyl-phenyl)- piperidin-1-yl-(5-phenethyl- pyridin-3-yl)-methanone
PDB Compounds: (A:) human beta2 tryptase

SCOP Domain Sequences for d2bm2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm2a1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOP Domain Coordinates for d2bm2a1:

Click to download the PDB-style file with coordinates for d2bm2a1.
(The format of our PDB-style files is described here.)

Timeline for d2bm2a1: