Lineage for d2bm1a2 (2bm1 A:4-282)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830179Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 830180Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 830186Domain d2bm1a2: 2bm1 A:4-282 [128754]
    Other proteins in same PDB: d2bm1a1, d2bm1a3, d2bm1a4, d2bm1a5
    automatically matched to d1dar_2
    complexed with gdp, mg; mutant

Details for d2bm1a2

PDB Entry: 2bm1 (more details), 2.6 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant g16v
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d2bm1a2:

Sequence, based on SEQRES records: (download)

>d2bm1a2 c.37.1.8 (A:4-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kveydlkrlrniviaahidagktttterilyytgrihkigevhegaatmdfmeqerergi
titaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwr
qaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrm
kaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelv
aairkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d2bm1a2 c.37.1.8 (A:4-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kveydlkrlrniviaahidagktttterilyytgriitaavttcfwkdhriniidtpghv
dftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwl
virtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldq
areyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkg
vqllldavvdylps

SCOP Domain Coordinates for d2bm1a2:

Click to download the PDB-style file with coordinates for d2bm1a2.
(The format of our PDB-style files is described here.)

Timeline for d2bm1a2: