| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
| Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries) |
| Domain d2bm0a4: 2bm0 A:404-478 [128751] Other proteins in same PDB: d2bm0a1, d2bm0a2, d2bm0a3 automatically matched to d1fnma4 complexed with gdp, mg; mutant |
PDB Entry: 2bm0 (more details), 2.4 Å
SCOPe Domain Sequences for d2bm0a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bm0a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgk
Timeline for d2bm0a4:
View in 3DDomains from same chain: (mouse over for more information) d2bm0a1, d2bm0a2, d2bm0a3, d2bm0a5 |