Lineage for d2bm0a3 (2bm0 A:479-599)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853012Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 853013Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries)
  8. 853016Domain d2bm0a3: 2bm0 A:479-599 [128750]
    Other proteins in same PDB: d2bm0a1, d2bm0a2, d2bm0a4, d2bm0a5
    automatically matched to d1dar_3
    complexed with gdp, mg; mutant

Details for d2bm0a3

PDB Entry: 2bm0 (more details), 2.4 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant t84a
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d2bm0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm0a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]}
pqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkey
ipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgd
p

SCOP Domain Coordinates for d2bm0a3:

Click to download the PDB-style file with coordinates for d2bm0a3.
(The format of our PDB-style files is described here.)

Timeline for d2bm0a3: