![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
![]() | Protein Elongation factor G (EF-G), domain IV [54213] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries) |
![]() | Domain d2bm0a3: 2bm0 A:479-599 [128750] Other proteins in same PDB: d2bm0a1, d2bm0a2, d2bm0a4, d2bm0a5 automatically matched to d1dar_3 complexed with gdp, mg; mutant |
PDB Entry: 2bm0 (more details), 2.4 Å
SCOPe Domain Sequences for d2bm0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bm0a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} pqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkey ipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgd p
Timeline for d2bm0a3:
![]() Domains from same chain: (mouse over for more information) d2bm0a1, d2bm0a2, d2bm0a4, d2bm0a5 |