Lineage for d2bm0a1 (2bm0 A:283-403)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669500Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 669539Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 669540Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)
  8. 669542Domain d2bm0a1: 2bm0 A:283-403 [128748]
    Other proteins in same PDB: d2bm0a2, d2bm0a3, d2bm0a4, d2bm0a5
    automatically matched to d1efga1
    complexed with gdp, mg; mutant

Details for d2bm0a1

PDB Entry: 2bm0 (more details), 2.4 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant t84a
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d2bm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm0a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

SCOP Domain Coordinates for d2bm0a1:

Click to download the PDB-style file with coordinates for d2bm0a1.
(The format of our PDB-style files is described here.)

Timeline for d2bm0a1: