Lineage for d2blua1 (2blu A:1-206)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663000Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 663001Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 663002Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 663010Protein Thaumatin [49876] (1 species)
  7. 663011Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (18 PDB entries)
  8. 663015Domain d2blua1: 2blu A:1-206 [128742]
    automatically matched to d1kwna_
    complexed with tla

Details for d2blua1

PDB Entry: 2blu (more details), 1.4 Å

PDB Description: thaumatin after a high dose x-ray "burn"
PDB Compounds: (A:) thaumatin I

SCOP Domain Sequences for d2blua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2blua1 b.25.1.1 (A:1-206) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpt

SCOP Domain Coordinates for d2blua1:

Click to download the PDB-style file with coordinates for d2blua1.
(The format of our PDB-style files is described here.)

Timeline for d2blua1: