SCOPe 2.05: Domain d2blra_: 2blr A:

Lineage for d2blra_ (2blr A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein automated matches [190195] (6 species)
   not a true protein

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (26 PDB entries)

8. Domain d2blra_: 2blr A: [128741]
   automated match to d1kwna_
   complexed with tla

Details for d2blra_

PDB Entry: 2blr, 1.4 Å

PDB Description: thaumatin before a high dose x-ray "burn"

PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d2blra_:

Sequence; same for both SEQRES and ATOM records:

>d2blra_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpt

Timeline for d2blra_:

• d2blra_ first appeared in SCOP 1.73, called d2blra1
  
• d2blra_ appears in SCOPe 2.04
  
• d2blra_ appears in SCOPe 2.06
  
• d2blra_ appears in the current release, SCOPe 2.08