Lineage for d2blnb2 (2bln B:1-203)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999370Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 999371Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 999372Family c.65.1.1: Formyltransferase [53329] (4 proteins)
  6. 999437Protein Polymyxin resistance protein ArnA, N-terminal domain [142569] (1 species)
  7. 999438Species Escherichia coli [TaxId:562] [142570] (3 PDB entries)
    Uniprot P77398 1-200! Uniprot P77398 1-203
  8. 999440Domain d2blnb2: 2bln B:1-203 [128737]
    Other proteins in same PDB: d2blna1, d2blnb1
    automatically matched to 2BLN A:1-203
    complexed with act, fon, u5p

Details for d2blnb2

PDB Entry: 2bln (more details), 1.2 Å

PDB Description: n-terminal formyltransferase domain of arna in complex with n-5-formyltetrahydrofolate and ump
PDB Compounds: (B:) protein yfbg

SCOPe Domain Sequences for d2blnb2:

Sequence, based on SEQRES records: (download)

>d2blnb2 c.65.1.1 (B:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgrrtp

Sequence, based on observed residues (ATOM records): (download)

>d2blnb2 c.65.1.1 (B:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdfygsvarlaaergipvyapdnvnhpl
wveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvnget
etgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnil
eiaqreneatcfgrrtp

SCOPe Domain Coordinates for d2blnb2:

Click to download the PDB-style file with coordinates for d2blnb2.
(The format of our PDB-style files is described here.)

Timeline for d2blnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2blnb1