Lineage for d2blna1 (2bln A:204-304)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064087Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2064088Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2064089Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 2064105Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species)
  7. 2064106Species Escherichia coli [TaxId:562] [141382] (4 PDB entries)
    Uniprot P77398 201-304! Uniprot P77398 204-304
  8. 2064107Domain d2blna1: 2bln A:204-304 [128734]
    Other proteins in same PDB: d2blna2, d2blnb2
    complexed with act, fon, u5p

Details for d2blna1

PDB Entry: 2bln (more details), 1.2 Å

PDB Description: n-terminal formyltransferase domain of arna in complex with n-5-formyltetrahydrofolate and ump
PDB Compounds: (A:) protein yfbg

SCOPe Domain Sequences for d2blna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2blna1 b.46.1.1 (A:204-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvisva
plliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl

SCOPe Domain Coordinates for d2blna1:

Click to download the PDB-style file with coordinates for d2blna1.
(The format of our PDB-style files is described here.)

Timeline for d2blna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2blna2