Lineage for d2bljm_ (2blj M:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717514Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
    Uniprot P02185
  8. 1717701Domain d2bljm_: 2blj M: [128732]
    automated match to d1ltw__
    complexed with cmo, hem

Details for d2bljm_

PDB Entry: 2blj (more details), 1.8 Å

PDB Description: structure of l29w mbco
PDB Compounds: (M:) Myoglobin

SCOPe Domain Sequences for d2bljm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bljm_ a.1.1.2 (M:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2bljm_:

Click to download the PDB-style file with coordinates for d2bljm_.
(The format of our PDB-style files is described here.)

Timeline for d2bljm_: