SCOPe 2.08: Domain d2bljm_: 2blj M:

Lineage for d2bljm_ (2blj M:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
   Uniprot P02185

8. Domain d2bljm_: 2blj M: [128732]
   automated match to d1ltw__
   complexed with cmo, hem

Details for d2bljm_

PDB Entry: 2blj, 1.8 Å

PDB Description: structure of l29w mbco

PDB Compounds: (M:) Myoglobin

SCOPe Domain Sequences for d2bljm_:

Sequence; same for both SEQRES and ATOM records:

>d2bljm_ a.1.1.2 (M:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2bljm_:

• d2bljm_ first appeared in SCOP 1.73, called d2bljm1
  
• d2bljm_ appears in SCOPe 2.07