Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries) |
Domain d2blha1: 2blh A:1-153 [128730] automatically matched to d1ltw__ complexed with hem; mutant |
PDB Entry: 2blh (more details), 1.77 Å
SCOP Domain Sequences for d2blha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2blha1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gnfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d2blha1: